PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G07070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 322aa    MW: 35406.9 Da    PI: 9.2138
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G07070.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.1e-1794140148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEde l + v+ +G + W+ Ia+ ++ gR +kqc++rw ++l
  OMERI07G07070.1  94 KGGWTREEDEVLRQMVRHHGDRKWAEIAKSLP-GRIGKQCRERWTNHL 140
                      688*****************************.************996 PP

2Myb_DNA-binding57.82.6e-18146188145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +g WT+eEd +l++a++ +G++ W++Iar ++ gR+++ +k++w+
  OMERI07G07070.1 146 KGIWTEEEDRKLIKAHQTYGNR-WSAIARSLP-GRSENTVKNHWN 188
                      678*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.58189144IPR017930Myb domain
SuperFamilySSF466891.21E-3091187IPR009057Homeodomain-like
SMARTSM007172.8E-1693142IPR001005SANT/Myb domain
PfamPF002499.5E-1694140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-2596144IPR009057Homeodomain-like
CDDcd001672.38E-1697140No hitNo description
PROSITE profilePS5129418.612145195IPR017930Myb domain
SMARTSM007171.3E-17145193IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-23145192IPR009057Homeodomain-like
PfamPF002491.7E-16146188IPR001005SANT/Myb domain
CDDcd001674.81E-15149191No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MAIDRMPDSH FMASSNGGAC YQNTHGTPIT MGVPNLGCLV ASIGMALSSS LMPERGLATA  60
NYNFVANFPE DAAMVPQQQQ LQAASSNSNS GLIKGGWTRE EDEVLRQMVR HHGDRKWAEI  120
AKSLPGRIGK QCRERWTNHL HPDIKKGIWT EEEDRKLIKA HQTYGNRWSA IARSLPGRSE  180
NTVKNHWNAT KRSLNSKRRL RKKNSEQAVP GQPSLLEEYI RSCQHATPHP PQPDLNLLNI  240
TPVVPHLNTS GYCLQFDARG NLQYGQLPVQ PHGISAQAGP SNVGTSGSTG GMDNNGVIQM  300
ASNQFVMPSE DGGILDMARW IS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C3e-405919226156MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-405919226156MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126151e-159CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645922.10.0PREDICTED: transcriptional activator Myb-like
TrEMBLA0A0E0E9J60.0A0A0E0E9J6_9ORYZ; Uncharacterized protein
STRINGBGIOSGA025449-PA1e-174(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-45myb domain protein 98